| Name | AK3L1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1088 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Dog |
| Antigen | AK3L1 antibody was raised using the middle region of AK3L1 corresponding to a region with amino acids RWIHPPSGRVYNLDFNPPHVHGIDDVTGEPLVQQEDDKPEAVAARLRQYK |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | AK3L1 Blocking Peptide |
| Description | Rabbit polyclonal AK3L1 antibody raised against the middle region of AK3L1 |
| Gene | AK3 |
| Supplier Page | Shop |