| Name | NKAIN4 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-7511 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | NKAIN4 antibody was raised using the middle region of NKAIN4 corresponding to a region with amino acids LLGFVCGCQVVSVFTDEEDSFDFIGGFDPFPLYHVNEKPSSLLSKQVYLP |
| Purity/Format | Affinity purified |
| Blocking Peptide | NKAIN4 Blocking Peptide |
| Description | Rabbit polyclonal NKAIN4 antibody raised against the middle region of NKAIN4 |
| Gene | NKAIN4 |
| Supplier Page | Shop |