| Name | RNF178 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6420 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | RNF178 antibody was raised using a synthetic peptide corresponding to a region with amino acids YVQCKVYVQLWKRLKAYNRVIYVQNCPETSKKNIFEKSPLTEPNFENKHG |
| Purity/Format | Affinity purified |
| Blocking Peptide | RNF178 Blocking Peptide |
| Description | Rabbit polyclonal RNF178 antibody |
| Gene | MARCH8 |
| Supplier Page | Shop |