| Name | LRRC2 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1280 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | LRRC2 antibody was raised using the C terminal of LRRC2 corresponding to a region with amino acids NAQCEDGNEIMESERDRQHFDKEVMKAYIEDLKERESVPSYTTKVSFSLQ |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | LRRC2 Blocking Peptide |
| Description | Rabbit polyclonal LRRC2 antibody raised against the C terminal of LRRC2 |
| Gene | LRRC2 |
| Supplier Page | Shop |