C1ORF111 antibody

Name C1ORF111 antibody
Supplier Fitzgerald
Catalog 70R-3654
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen C1ORF111 antibody was raised using the N terminal Of C1Orf111 corresponding to a region with amino acids DIAKTAVPTEASSPAQALPPQYQSIIVRQGIQNTALSPDCSLGDTQHGEK
Purity/Format Affinity purified
Blocking Peptide C1ORF111 Blocking Peptide
Description Rabbit polyclonal C1ORF111 antibody raised against the N terminal Of C1Orf111
Gene C1orf111
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.