Name | TRIM54 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-2019 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat |
Antigen | TRIM54 antibody was raised using the N terminal of TRIM54 corresponding to a region with amino acids NFTVGFKPLLGDAHSMDNLEKQLICPICLEMFSKPVVILPCQHNLCRKCA |
Purity/Format | Affinity purified |
Blocking Peptide | TRIM54 Blocking Peptide |
Description | Rabbit polyclonal TRIM54 antibody raised against the N terminal of TRIM54 |
Gene | TRIM54 |
Supplier Page | Shop |