| Name | EEF1G antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2756 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | EEF1G antibody was raised using the middle region of EEF1G corresponding to a region with amino acids RAVLGEVKLCEKMAQFDAKKFAETQPKKDTPRKEKGSREEKQKPQAERKE |
| Purity/Format | Affinity purified |
| Blocking Peptide | EEF1G Blocking Peptide |
| Description | Rabbit polyclonal EEF1G antibody raised against the middle region of EEF1G |
| Gene | EEF1G |
| Supplier Page | Shop |