| Name | Nephronectin antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2211 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Dog |
| Antigen | Nephronectin antibody was raised using the middle region of NPNT corresponding to a region with amino acids TTGLTTIAPAASTPPGGITVDNRVQTDPQKPRGDVFIPRQPSNDLFEIFE |
| Purity/Format | Affinity purified |
| Blocking Peptide | Nephronectin Blocking Peptide |
| Description | Rabbit polyclonal Nephronectin antibody raised against the middle region of NPNT |
| Gene | NPNT |
| Supplier Page | Shop |