| Name | CAPS antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5864 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | CAPS antibody was raised using the N terminal of CAPS corresponding to a region with amino acids DAVDATMEKLRAQCLSRGASGIQGLARFFRQLDRDGSRSLDADEFRQGLA |
| Purity/Format | Affinity purified |
| Blocking Peptide | CAPS Blocking Peptide |
| Description | Rabbit polyclonal CAPS antibody raised against the N terminal of CAPS |
| Gene | CAPS |
| Supplier Page | Shop |