IARS antibody

Name IARS antibody
Supplier Fitzgerald
Catalog 70R-3173
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen IARS antibody was raised using the middle region of IARS corresponding to a region with amino acids YEAAKVFGLRSRKLKLFLNETQTQEITEDIPVKTLNMKTVYVSVLPTTAD
Purity/Format Affinity purified
Blocking Peptide IARS Blocking Peptide
Description Rabbit polyclonal IARS antibody raised against the middle region of IARS
Gene IARS
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.