| Name | HNRPM antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4998 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | HNRPM antibody was raised using the N terminal Of Hnrpm corresponding to a region with amino acids ATEIKMEEESGAPGVPSGNGAPGPKGEGERPAQNEKRKEKNIKRGGNRFE |
| Purity/Format | Affinity purified |
| Blocking Peptide | HNRPM Blocking Peptide |
| Description | Rabbit polyclonal HNRPM antibody raised against the N terminal Of Hnrpm |
| Gene | HNRNPM |
| Supplier Page | Shop |