| Name | FAM38B antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6676 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | FAM38B antibody was raised using the middle region of FAM38B corresponding to a region with amino acids AGNSTESSKTPVTIEKIYPYYVKAPSDSNSKPIKQLLSENNFMDITIILS |
| Purity/Format | Affinity purified |
| Blocking Peptide | FAM38B Blocking Peptide |
| Description | Rabbit polyclonal FAM38B antibody raised against the middle region of FAM38B |
| Gene | PIEZO2 |
| Supplier Page | Shop |