Name | FAM38B antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-6676 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat |
Antigen | FAM38B antibody was raised using the middle region of FAM38B corresponding to a region with amino acids AGNSTESSKTPVTIEKIYPYYVKAPSDSNSKPIKQLLSENNFMDITIILS |
Purity/Format | Affinity purified |
Blocking Peptide | FAM38B Blocking Peptide |
Description | Rabbit polyclonal FAM38B antibody raised against the middle region of FAM38B |
Gene | PIEZO2 |
Supplier Page | Shop |