| Name | GADD45B antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5930 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | GADD45B antibody was raised using the middle region of GADD45B corresponding to a region with amino acids FCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCLLVTNPHTDAW |
| Purity/Format | Affinity purified |
| Blocking Peptide | GADD45B Blocking Peptide |
| Description | Rabbit polyclonal GADD45B antibody raised against the middle region of GADD45B |
| Gene | GADD45B |
| Supplier Page | Shop |