| Name | ST8SIA6 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6324 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | ST8SIA6 antibody was raised using the middle region of ST8SIA6 corresponding to a region with amino acids LEESKARQKVLFFHPKYLKDLALFWRTKGVTAYRLSTGLMITSVAVELCK |
| Purity/Format | Affinity purified |
| Blocking Peptide | ST8SIA6 Blocking Peptide |
| Description | Rabbit polyclonal ST8SIA6 antibody raised against the middle region of ST8SIA6 |
| Gene | ST8SIA6 |
| Supplier Page | Shop |