| Name | SR140 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4843 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | SR140 antibody was raised using the N terminal of SR140 corresponding to a region with amino acids NLSRPLLENKLKAFSIGKMSTAKRTLSKKEQEELKKKEDEKAAAEIYEEF |
| Purity/Format | Affinity purified |
| Blocking Peptide | SR140 Blocking Peptide |
| Description | Rabbit polyclonal SR140 antibody raised against the N terminal of SR140 |
| Gene | U2SURP |
| Supplier Page | Shop |