| Name | MRS2L antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6521 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | MRS2L antibody was raised using the middle region of Mrs2L corresponding to a region with amino acids LDALVDPKHSSVDRSKLHILLQNGKSLSELETDIKIFKESILEILDEEEL |
| Purity/Format | Affinity purified |
| Blocking Peptide | MRS2L Blocking Peptide |
| Description | Rabbit polyclonal MRS2L antibody raised against the middle region of Mrs2L |
| Gene | MRS2 |
| Supplier Page | Shop |