| Name | ERP29 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6713 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | ERP29 antibody was raised using the N terminal of ERP29 corresponding to a region with amino acids MAAAVPRAAFLSPLLPLLLGFLLLSAPHGGSGLHTKGALPLDTVTFYKVI |
| Purity/Format | Affinity purified |
| Blocking Peptide | ERP29 Blocking Peptide |
| Description | Rabbit polyclonal ERP29 antibody raised against the N terminal of ERP29 |
| Gene | ERP29 |
| Supplier Page | Shop |