| Name | FAM46C antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3947 |
| Prices | $375.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | FAM46C antibody was raised using the middle region of FAM46C corresponding to a region with amino acids LIATKNPEEIRGGGLLKYSNLLVRDFRPTDQEEIKTLERYMCSRFFIDFP |
| Purity/Format | Affinity purified |
| Blocking Peptide | FAM46C Blocking Peptide |
| Description | Rabbit polyclonal FAM46C antibody raised against the middle region of FAM46C |
| Gene | FAM46C |
| Supplier Page | Shop |