Name | FAM46C antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-3947 |
Prices | $375.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | FAM46C antibody was raised using the middle region of FAM46C corresponding to a region with amino acids LIATKNPEEIRGGGLLKYSNLLVRDFRPTDQEEIKTLERYMCSRFFIDFP |
Purity/Format | Affinity purified |
Blocking Peptide | FAM46C Blocking Peptide |
Description | Rabbit polyclonal FAM46C antibody raised against the middle region of FAM46C |
Gene | FAM46C |
Supplier Page | Shop |