Name | EEF1A1 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-1029 |
Prices | $275.00 |
Sizes | 100 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat |
Antigen | EEF1A1 antibody was raised using the C terminal of EEF1A1 corresponding to a region with amino acids IVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVDKKAAGAGK |
Purity/Format | Total IgG Protein A purified |
Blocking Peptide | EEF1A1 Blocking Peptide |
Description | Rabbit polyclonal EEF1A1 antibody raised against the C terminal of EEF1A1 |
Gene | EEF1A1 |
Supplier Page | Shop |