| Name | Tenomodulin antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6905 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | Tenomodulin antibody was raised using the N terminal of TNMD corresponding to a region with amino acids KKKIYMEIDPVTRTEIFRSGNGTDETLEVHDFKNGYTGIYFVGLQKCFIK |
| Purity/Format | Affinity purified |
| Blocking Peptide | Tenomodulin Blocking Peptide |
| Description | Rabbit polyclonal Tenomodulin antibody raised against the N terminal of TNMD |
| Gene | TNMD |
| Supplier Page | Shop |