| Name | RDBP antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4683 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | RDBP antibody was raised using the N terminal of RDBP corresponding to a region with amino acids LVIPPGLSEEEEALQKKFNKLKKKKKALLALKKQSSSSTTSQGGVKRSLS |
| Purity/Format | Affinity purified |
| Blocking Peptide | RDBP Blocking Peptide |
| Description | Rabbit polyclonal RDBP antibody raised against the N terminal of RDBP |
| Gene | ATP1A3 |
| Supplier Page | Shop |