| Name | SRPRB antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1768 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | SRPRB antibody was raised using the C terminal of SRPRB corresponding to a region with amino acids APAQLGKKGKEFEFSQLPLKVEFLECSAKGGRGDVGSADIQDLEKWLAKI |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | SRPRB Blocking Peptide |
| Description | Rabbit polyclonal SRPRB antibody raised against the C terminal of SRPRB |
| Gene | SRPRB |
| Supplier Page | Shop |