| Name | SLCO1C1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6553 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | SLCO1C1 antibody was raised using the N terminal of SLCO1C1 corresponding to a region with amino acids VDTSSSMWIYVFLGNLLRGIGETPIQPLGIAYLDDFASEDNAAFYIGCVQ |
| Purity/Format | Affinity purified |
| Blocking Peptide | SLCO1C1 Blocking Peptide |
| Description | Rabbit polyclonal SLCO1C1 antibody raised against the N terminal of SLCO1C1 |
| Gene | SLCO1C1 |
| Supplier Page | Shop |