CYP11A1 antibody

Name CYP11A1 antibody
Supplier Fitzgerald
Catalog 70R-2505
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen CYP11A1 antibody was raised using the N terminal of CYP11A1 corresponding to a region with amino acids QKGSVHHDYRGILYRLLGDSKMSFEDIKANVTEMLAGGVDTTSMTLQWHL
Purity/Format Affinity purified
Blocking Peptide CYP11A1 Blocking Peptide
Description Rabbit polyclonal CYP11A1 antibody raised against the N terminal of CYP11A1
Gene CYP11A1
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.