Name | MCM8 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-1607 |
Prices | $275.00 |
Sizes | 100 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse |
Antigen | MCM8 antibody was raised using the N terminal of MCM8 corresponding to a region with amino acids ELRDAPEKTLACMGLAIHQVLTKDLERHAAELQAQEGLSNDGETMVNVPH |
Purity/Format | Total IgG Protein A purified |
Blocking Peptide | MCM8 Blocking Peptide |
Description | Rabbit polyclonal MCM8 antibody raised against the N terminal of MCM8 |
Gene | MCM8 |
Supplier Page | Shop |