LAYN antibody

Name LAYN antibody
Supplier Fitzgerald
Catalog 70R-7484
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen LAYN antibody was raised using the N terminal of LAYN corresponding to a region with amino acids CYKVIYFHDTSRRLNFEEAKEACRRDGGQLVSIESEDEQKLIEKFIENLL
Purity/Format Affinity purified
Blocking Peptide LAYN Blocking Peptide
Description Rabbit polyclonal LAYN antibody raised against the N terminal of LAYN
Gene LAYN
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.