EMID1 antibody

Name EMID1 antibody
Supplier Fitzgerald
Catalog 70R-7323
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen EMID1 antibody was raised using the C terminal of EMID1 corresponding to a region with amino acids TMIGLYEPELGSGAGPAGTGTPSLLRGKRGGHATNYRIVAPRSRDERG
Purity/Format Affinity purified
Blocking Peptide EMID1 Blocking Peptide
Description Rabbit polyclonal EMID1 antibody raised against the C terminal of EMID1
Gene EMID1
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.