ACCN1 antibody

Name ACCN1 antibody
Supplier Fitzgerald
Catalog 70R-5099
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen ACCN1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LLDLLGKEEDEGSHDENVSTCDTMPNHSETISHTVNVPLQTTLGTLEEIA
Purity/Format Affinity purified
Blocking Peptide ACCN1 Blocking Peptide
Description Rabbit polyclonal ACCN1 antibody
Gene ASIC2
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.