| Name | ASB8 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5837 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | ASB8 antibody was raised using the N terminal of ASB8 corresponding to a region with amino acids MSSSMWYIMQSIQSKYSLSERLIRTIAAIRSFPHDNVEDLIRGGADVNCT |
| Purity/Format | Affinity purified |
| Blocking Peptide | ASB8 Blocking Peptide |
| Description | Rabbit polyclonal ASB8 antibody raised against the N terminal of ASB8 |
| Gene | ASB8 |
| Supplier Page | Shop |