| Name | UGT1A9 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-7516 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Rat |
| Antigen | UGT1A9 antibody was raised using the N terminal of UGT1A9 corresponding to a region with amino acids LLMGSYNDIFDLFFSNCRSLFKDKKLVEYLKESSFDAVFLDPFDNCGLIV |
| Purity/Format | Affinity purified |
| Blocking Peptide | UGT1A9 Blocking Peptide |
| Description | Rabbit polyclonal UGT1A9 antibody raised against the N terminal of UGT1A9 |
| Gene | UGT1A9 |
| Supplier Page | Shop |