| Name | SDSL antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2921 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | SDSL antibody was raised using the N terminal of SDSL corresponding to a region with amino acids MDGPVAEHAKQEPFHVVTPLLESWALSQVAGMPVFLKCENVQPSGSFKIR |
| Purity/Format | Affinity purified |
| Blocking Peptide | SDSL Blocking Peptide |
| Description | Rabbit polyclonal SDSL antibody raised against the N terminal of SDSL |
| Gene | SDSL |
| Supplier Page | Shop |