| Name | LRRC56 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4203 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | LRRC56 antibody was raised using the N terminal of LRRC56 corresponding to a region with amino acids LEMCVDTREGSLGNFGVHLPNLDQLKLNGSHLGSLRDLGTSLGHLQVLWL |
| Purity/Format | Affinity purified |
| Blocking Peptide | LRRC56 Blocking Peptide |
| Description | Rabbit polyclonal LRRC56 antibody raised against the N terminal of LRRC56 |
| Gene | LRRC56 |
| Supplier Page | Shop |