| Name | RELB antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1286 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | RELB antibody was raised using the C terminal of RELB corresponding to a region with amino acids GPEPLTLDSYQAPGPGDGGTASLVGSNMFPNHYREAAFGGGLLSPGPEAT |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | RELB Blocking Peptide |
| Description | Rabbit polyclonal RELB antibody raised against the C terminal of RELB |
| Gene | RELB |
| Supplier Page | Shop |