Name | IGFALS antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-6072 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat |
Antigen | IGFALS antibody was raised using the middle region of IGFALS corresponding to a region with amino acids DCGCPLKALRDFALQNPSAVPRFVQAICEGDDCQPPAYTYNNITCASPPE |
Purity/Format | Affinity purified |
Blocking Peptide | IGFALS Blocking Peptide |
Description | Rabbit polyclonal IGFALS antibody raised against the middle region of IGFALS |
Gene | IGFALS |
Supplier Page | Shop |