| Name | IGFALS antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6072 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | IGFALS antibody was raised using the middle region of IGFALS corresponding to a region with amino acids DCGCPLKALRDFALQNPSAVPRFVQAICEGDDCQPPAYTYNNITCASPPE |
| Purity/Format | Affinity purified |
| Blocking Peptide | IGFALS Blocking Peptide |
| Description | Rabbit polyclonal IGFALS antibody raised against the middle region of IGFALS |
| Gene | IGFALS |
| Supplier Page | Shop |