| Name | C12ORF49 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-7355 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | C12ORF49 antibody was raised using the C terminal Of C12Orf49 corresponding to a region with amino acids LERFLNRAAVAFQNLFMAVEDHFELCLAKCRTSSQSVQHENTYRDPIAKY |
| Purity/Format | Affinity purified |
| Blocking Peptide | C12ORF49 Blocking Peptide |
| Description | Rabbit polyclonal C12ORF49 antibody raised against the C terminal Of C12Orf49 |
| Gene | C12orf49 |
| Supplier Page | Shop |