| Name | TMEM166 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6649 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | TMEM166 antibody was raised using the N terminal Of Tmem166 corresponding to a region with amino acids RLPLSHSPEHVEMALLSNILAAYSFVSENPERAALYFVSGVCIGLVLTLA |
| Purity/Format | Affinity purified |
| Blocking Peptide | TMEM166 Blocking Peptide |
| Description | Rabbit polyclonal TMEM166 antibody raised against the N terminal Of Tmem166 |
| Gene | EVA1A |
| Supplier Page | Shop |