| Name | VPS37C antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3338 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | VPS37C antibody was raised using a synthetic peptide corresponding to a region with amino acids LQLEREMALATNRSLAERNLEFQGPLEISRSNLSDRYQELRKLVERCQEQ |
| Purity/Format | Affinity purified |
| Blocking Peptide | VPS37C Blocking Peptide |
| Description | Rabbit polyclonal VPS37C antibody |
| Gene | VPS37C |
| Supplier Page | Shop |