Name | Thymopoietin antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-6297 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat |
Antigen | Thymopoietin antibody was raised using the N terminal of TMPO corresponding to a region with amino acids MPEFLEDPSVLTKDKLKSELVANNVTLPAGEQRKDVYVQLYLQHLTARNR |
Purity/Format | Affinity purified |
Blocking Peptide | Thymopoietin Blocking Peptide |
Description | Rabbit polyclonal Thymopoietin antibody raised against the N terminal of TMPO |
Gene | TMPO |
Supplier Page | Shop |