| Name | TMCC2 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-7035 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | TMCC2 antibody was raised using the N terminal of TMCC2 corresponding to a region with amino acids GETTGANSAGGPTSDAGAAAAPNPGPRSKPPDLKKIQQLSEGSMFGHGLK |
| Purity/Format | Affinity purified |
| Blocking Peptide | TMCC2 Blocking Peptide |
| Description | Rabbit polyclonal TMCC2 antibody raised against the N terminal of TMCC2 |
| Gene | TMCC2 |
| Supplier Page | Shop |