Name | Annexin A6 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-1672 |
Prices | $275.00 |
Sizes | 100 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Annexin A6 antibody was raised using the C terminal of ANXA6 corresponding to a region with amino acids SDTSGHFRRILISLATGHREEGGENLDQAREDAQVAAEILEIADTPSGDK |
Purity/Format | Total IgG Protein A purified |
Blocking Peptide | Annexin A6 Blocking Peptide |
Description | Rabbit polyclonal Annexin A6 antibody raised against the C terminal of ANXA6 |
Gene | ANXA6 |
Supplier Page | Shop |