Name | KIF22 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-5549 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | KIF22 antibody was raised using the N terminal of KIF22 corresponding to a region with amino acids CSLEIANWRNHQETLKYQFDAFYGERSTQQDIYAGSVQPILRHLLEGQNA |
Purity/Format | Affinity purified |
Blocking Peptide | KIF22 Blocking Peptide |
Description | Rabbit polyclonal KIF22 antibody raised against the N terminal of KIF22 |
Gene | KIF22 |
Supplier Page | Shop |