KIF22 antibody

Name KIF22 antibody
Supplier Fitzgerald
Catalog 70R-5549
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen KIF22 antibody was raised using the N terminal of KIF22 corresponding to a region with amino acids CSLEIANWRNHQETLKYQFDAFYGERSTQQDIYAGSVQPILRHLLEGQNA
Purity/Format Affinity purified
Blocking Peptide KIF22 Blocking Peptide
Description Rabbit polyclonal KIF22 antibody raised against the N terminal of KIF22
Gene KIF22
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.