| Name | GMPS antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2088 |
| Prices | $375.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | GMPS antibody was raised using the middle region of GMPS corresponding to a region with amino acids VCTALLNRALNQEQVIAVHIDNGFMRKRESQSVEEALKKLGIQVKVINAA |
| Purity/Format | Affinity purified |
| Blocking Peptide | GMPS Blocking Peptide |
| Description | Rabbit polyclonal GMPS antibody raised against the middle region of GMPS |
| Gene | GMPS |
| Supplier Page | Shop |