ODF2 antibody

Name ODF2 antibody
Supplier Fitzgerald
Catalog 70R-3915
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen ODF2 antibody was raised using the N terminal of ODF2 corresponding to a region with amino acids MSASSSGGSPRFPSCGKNGVTSLTQKKVLRAPCGAPSVTVTKSHKRGMKG
Purity/Format Affinity purified
Blocking Peptide ODF2 Blocking Peptide
Description Rabbit polyclonal ODF2 antibody raised against the N terminal of ODF2
Gene ODF2
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.