| Name | CSGLCA-T antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2825 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | CSGLCA-T antibody was raised using the N terminal Of Csglca-T corresponding to a region with amino acids SLLRVSWIQGEGEDPCVEAVGERGGPQNPDSRARLDQSDEDFKPRIVPYY |
| Purity/Format | Affinity purified |
| Blocking Peptide | CSGLCA-T Blocking Peptide |
| Description | Rabbit polyclonal CSGLCA-T antibody raised against the N terminal Of Csglca-T |
| Gene | CHPF2 |
| Supplier Page | Shop |