| Name | GRIN2B antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5195 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | GRIN2B antibody was raised using the middle region of GRIN2B corresponding to a region with amino acids RSPDHKRYFRDKEGLRDFYLDQFRTKENSPHWEHVDLTDIYKERSDDFKR |
| Purity/Format | Affinity purified |
| Blocking Peptide | GRIN2B Blocking Peptide |
| Description | Rabbit polyclonal GRIN2B antibody raised against the middle region of GRIN2B |
| Gene | GRIN2B |
| Supplier Page | Shop |