| Name | GRIK2 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5200 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Dog, Zebrafish |
| Antigen | GRIK2 antibody was raised using the C terminal of GRIK2 corresponding to a region with amino acids TANLAAFLTVERMESPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKIST |
| Purity/Format | Affinity purified |
| Blocking Peptide | GRIK2 Blocking Peptide |
| Description | Rabbit polyclonal GRIK2 antibody raised against the C terminal of GRIK2 |
| Gene | GRIK5 |
| Supplier Page | Shop |