| Name | TMEM69 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6878 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human |
| Antigen | TMEM69 antibody was raised using the middle region of TMEM69 corresponding to a region with amino acids AYGASFLSFLGGIRWGFALPEGSPAKPDYLNLASSAAPLFFSWFAFLISE |
| Purity/Format | Affinity purified |
| Blocking Peptide | TMEM69 Blocking Peptide |
| Description | Rabbit polyclonal TMEM69 antibody raised against the middle region of TMEM69 |
| Gene | TMEM69 |
| Supplier Page | Shop |