| Name | HNRNPR antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4656 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | HNRNPR antibody was raised using the N terminal of HNRNPR corresponding to a region with amino acids ANQVNGNAVQLKEEEEPMDTSSVTHTEHYKTLIEAGLPQKVAERLDEIFQ |
| Purity/Format | Affinity purified |
| Blocking Peptide | HNRNPR Blocking Peptide |
| Description | Rabbit polyclonal HNRNPR antibody raised against the N terminal of HNRNPR |
| Gene | HNRNPR |
| Supplier Page | Shop |