UMPS antibody

Name UMPS antibody
Supplier Fitzgerald
Catalog 70R-2670
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse
Antigen UMPS antibody was raised using the C terminal of UMPS corresponding to a region with amino acids VGFISGSRVSMKPEFLHLTPGVQLEAGGDNLGQQYNSPQEVIGKRGSDII
Purity/Format Affinity purified
Blocking Peptide UMPS Blocking Peptide
Description Rabbit polyclonal UMPS antibody raised against the C terminal of UMPS
Gene UMPS
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.